A2 Gir Cow Ghee at an Unbeatable Price of 1199
Best
Seller

Buffalo Bilona Ghee

799.00 9,500.00
561 people are viewing this right now
1 LTR 15 KG 2 LTR 5 LTR
Estimated Delivery:
24 - 26 May, 2024
Free Shipping & Returns:
On all orders over 1,299.00
Trust Badge
Guaranteed safe & secure checkout

Description

Bhumi Organic Pure Natural Desi Buffalo Ghee stands out for its exceptional quality and natural composition. Here’s a summary of its key attributes:

Key Features:

  1. Quality Ingredients: Made from indigenous Desi buffalo milk, processed using traditional churning methods that retain the natural nutrients.
  2. Chemical-Free: Completely free from preservatives, chemicals, or additives, ensuring purity and naturalness.
  3. Rich Aroma and Flavor: Offers a distinct taste and aroma, enhancing the flavor profile of various dishes.
  4. Nutrient-rich: enriched with vitamins, minerals, and antioxidants, contributing to multiple health benefits.
  5. Lactose-Free: Suitable for individuals with lactose intolerance, offering an alternative for those sensitive to dairy.
  6. Premium Packaging: Packaged in high-quality containers to maintain freshness and flavor.

Health Benefits:

  1. Boosts Immunity: rich in nutrients that support the immune system, aiding in overall health.
  2. Aids Digestion: Helps in improving digestion, potentially alleviating digestive discomfort.
  3. Promotes Cardiovascular Health: contains nutrients beneficial for heart health, contributing to overall cardiovascular wellness.
  4. Lactose Intolerance Friendly: Suitable for individuals who are lactose intolerant, offering a dairy product without lactose-related issues.

Versatile Usage:

  1. Cooking: A versatile ingredient suitable for various culinary uses, it enhances the taste and nutritional value of dishes.
  2. Health Conscious Choice: Offers a natural alternative for those seeking organic and nutrient-rich dairy products.

Quick Comparison

SettingsBuffalo Bilona Ghee removeA2 Gir Cow Bilona Ghee removeShatavari Ghee, Gir Cow A2 Cultured removeA2 Gir Cow Full Moon Bilona Ghee removeTriphala Ghee, Gir Cow A2 Cultured removeAshwagandha Ghee, Gir Cow A2 Cultured remove
NameBuffalo Bilona Ghee removeA2 Gir Cow Bilona Ghee removeShatavari Ghee, Gir Cow A2 Cultured removeA2 Gir Cow Full Moon Bilona Ghee removeTriphala Ghee, Gir Cow A2 Cultured removeAshwagandha Ghee, Gir Cow A2 Cultured remove
Image
SKUBUFFALOGHEEGIRGHEESHATAVARIGHEEFMGIRGHEETRIPHALAGHEEASHWAGANDHAGHEE
Rating
4.71
568 reviews
Price
799.00 9,500.00
Sale !
399.00 14,999.00
Sale !
749.00 2,999.00
Sale !
499.00 19,999.00
Sale !
749.00 2,999.00
Sale !
749.00 2,999.00
Sale !
Stock
Availability
Add to cart

Description
  • Premium Quality: Pure Whites Premium Desi Ghee is made from the milk of the Murrah breed of buffalo, which is a domestic water buffalo that originated in India. It is the best buffalo breed in India, resistant to diseases.
  • No Harmful Chemicals: We follow traditional and ethical practices to maintain the quality and purity of ghee. Pure Whites Desi Ghee contains no additives, no preservatives, and no added colors—just wholesome goodness.
  • Murrah buffalo ghee can act as a remedy for stomach ulcers and other digestive issues. metabolism, consumption can also help in relieving issues like gastritis, constipation, and other stomach-related ailments.
  • Reveal the richness of ghee: The premium Desi Buffalo milk is used to make our ghee full of nutrients such as calcium, iron, sodium, and fat-soluble vitamins A, D, and E.
  • Desi Buffalo ghee: Our Buffalo desi ghee is full of nutritive fatty acids, an ideal fat source for an Indian vegetarian diet. Regular consumption of our high-quality ghee helps reduce cholesterol and improves the heart's functioning.
  • Made from the milk of A2 Gir cows using the traditional Bilona method, ensuring that the ghee is pure and natural.
  • It contains no preservatives, chemicals, or additives, making it a healthier and safer alternative to regular ghee.
  • Retains all the natural nutrients of the milk, providing various health benefits.
  • It is rich in flavor and aroma, making it a versatile ingredient for cooking and baking.
  • Contains essential fatty acids like omega-3 and omega-6, which are beneficial for heart health, brain function, and overall well-being.
  • Lactose-free, making it a suitable option for people who are lactose intolerant.
  • It comes in premium quality packaging that preserves the ghee's freshness and flavour.
  • Produced by Bhumi Organic, a trusted and renowned brand for organic and natural products.
 
  • Infuse Shatavari herb into ghee for combined benefits.
  • Supports women's health: menstrual, fertility, and hormonal balance.
  • Rooted in Ayurveda for holistic wellness,
  • a versatile supplement for overall well-being.
  • Potential aid for lactation and various life stages.
  • Professional guidance is recommended for usage.
  • Bhumi Organic Full Moon Cultured A2 Desi Gir Cow Bilona Ghee is made from the milk of Desi Gir cows.
  • The ghee is made by fermenting milk under full moon light. This process enhances the flavor and nutritional value of the ghee.
  • The ghee is free from any preservatives, chemicals, or additives, making it a pure and natural product.
  • Bhumi Organic Full Moon Cultured A2 Desi Gir Cow Bilona Ghee is rich in essential fatty acids, vitamins, and probiotics.
  • Ghee is considered to be beneficial for overall health and well-being, and it is also known to improve digestion, boost immunity, and enhance the skin and hair.
  • Beneficial for weak eyesight
  • Improves bowel system
  • Help balance Vata and Pitta dosha in the body
  • Reduces mental fatigue
  • It helps improve appetite
  • Good for digestion
  • Excellent for skin and hair health
  • Prevents from infections, colds, and coughs
  • Ashwagandha Ghee, Gir Cow A2 Cultured: Blend of Ashwagandha herb and ghee from Gir cows (A2 type)
  • Benefits: Believed to aid stress management and overall well-being
  • Cultural and Nutritional Value: Gir cow's A2 ghee is considered more digestible
  • Traditional Practice: Rooted in Ayurveda for health support
  • Consultation is recommended, especially if you have health conditions or take medications
ContentBhumi Organic Pure Natural Desi Buffalo Ghee stands out for its exceptional quality and natural composition. Here's a summary of its key attributes:

Key Features:

  1. Quality Ingredients: Made from indigenous Desi buffalo milk, processed using traditional churning methods that retain the natural nutrients.
  2. Chemical-Free: Completely free from preservatives, chemicals, or additives, ensuring purity and naturalness.
  3. Rich Aroma and Flavor: Offers a distinct taste and aroma, enhancing the flavor profile of various dishes.
  4. Nutrient-rich: enriched with vitamins, minerals, and antioxidants, contributing to multiple health benefits.
  5. Lactose-Free: Suitable for individuals with lactose intolerance, offering an alternative for those sensitive to dairy.
  6. Premium Packaging: Packaged in high-quality containers to maintain freshness and flavor.

Health Benefits:

  1. Boosts Immunity: rich in nutrients that support the immune system, aiding in overall health.
  2. Aids Digestion: Helps in improving digestion, potentially alleviating digestive discomfort.
  3. Promotes Cardiovascular Health: contains nutrients beneficial for heart health, contributing to overall cardiovascular wellness.
  4. Lactose Intolerance Friendly: Suitable for individuals who are lactose intolerant, offering a dairy product without lactose-related issues.

Versatile Usage:

  1. Cooking: A versatile ingredient suitable for various culinary uses, it enhances the taste and nutritional value of dishes.
  2. Health Conscious Choice: Offers a natural alternative for those seeking organic and nutrient-rich dairy products.

Bhumi Organic A2 Gir Cow Bilona Ghee has several health benefits, including:

  1. Boosts Immunity: The ghee contains butyric acid, which is known to boost the immune system.
  2. Promotes Digestive Health: It aids in digestion by stimulating the secretion of digestive enzymes and reducing inflammation in the gut.
  3. Enhances Brain Function: The essential fatty acids present in ghee improve brain function, memory, and cognitive performance.
  4. Improves Heart Health: The ghee is rich in conjugated linoleic acid (CLA), which reduces the risk of heart disease and improves the blood lipid profile.
  5. Supports Weight Loss: The ghee helps in reducing belly fat and improving metabolism, thereby aiding in weight loss.
  6. Nourishes Skin and Hair: It contains vitamin E, which is beneficial for skin and hair health, and also acts as a natural moisturizer
  • Shatavari Herb: Revered in Ayurveda as the "Queen of Herbs," known for supporting the female reproductive system, hormonal balance, and overall wellness.
  • Ghee Fusion: Blends the therapeutic qualities of Shatavari with the nutritional richness of ghee, often sourced from cow's milk.
  • Potential Benefits: Traditionally associated with menstrual health, fertility, lactation support, and overall vitality in women.
  • Ayurvedic Tradition: Deeply rooted in Ayurveda, it is used to enhance women's health and hormonal equilibrium.
  • Usage: Commonly included in diets to aid reproductive health, hormonal balance, and overall well-being in women.
  • Consultation Recommended: For women seeking specific benefits, consulting healthcare or Ayurvedic experts for guidance on usage and dosage is recommended.

Bhumi Organic Full Moon Cultured A2 Desi Gir Cow Bilona Ghee offers a variety of benefits to those who consume it.

  1. Nutrient-rich: packed with essential fatty acids, vitamins, and probiotics for digestion, immunity, and skin health.
  2. Full-bodied Flavor: Crafted traditionally, this ghee offers a rich, buttery taste, perfect for cooking, baking, or spreading.
  3. Natural Remedy: Known for potential anti-inflammatory benefits and suitability for those with ghee sensitivities.
  4. Digestive Ease: The A2 protein makes it gentler on digestion compared to regular ghee.
  5. Pure and Organic: Free from additives and chemicals, and made from the milk of Desi Gir cows raised in an organic environment.
  6. Culinary Marvel: Elevates the taste of dishes while enhancing overall flavors in the kitchen.
Triphala Ghee is an Ayurvedic medicine, in herbal ghee form. This medicine has ghee as its base. It is used for preparatory procedures for Panchakarma and also as medicine, mainly for eye diseases. Triphala refers to a group of three fruits: Haritaki, Vibhitaki, and Amla. Triphala is the main ingredient in this medicine. Triphala Ghee Ingredients Gir Cow Milk, Gir Cow Ghee, Triphala, Haritaki, Vibhitaki, Amla, Trikatu, Long Piper, Ginger, Darksha, Madhuka, Katukarohini, Prapaundarika, Cardamom, Vidanga, Nagakeshar, Nilotpala, Shweta Sariva, Krishna Sariva, Chandana (Sandalwood), Heartwood, Turmeric, Daruharidra, Triphala Kashayam Triphala Ghee benefits It is widely used as medicine and also in a preparatory procedure called Snehakarma for the treatment of tumors, early-stage cataracts, erysipelas, excessive discharge in women, eye pain with itching and discharge, cough, edema, hair fall, intermittent fever, pterygium, and such other eye and eyelid-related diseases. Useful in constipation, IBS-C, and low digestion strength. Myopia, hypermetropia, retinitis pigmentosa, astigmatism, and macular degeneration of the eye are used both for external and oral use. Ghee, being a very good rejuvenator and moistening agent, is very soothing for the eyes. It also relieves eye irritation. Consult your doctor before using it as an eye drop. Effect on Tridosha Calms Pitta and Vata Triphala Ghee Uses As medicine quarter to half teaspoon with water, usually before food, once or twice a day, or as directed by an Ayurvedic doctor. For the Panchakarma preparation – Snehana procedure, the dose depends on the disease status and the judgment of the Ayurvedic doctor. It may be taken by itself or mixed with Triphala choornam. 2 drops of this ghee are put on the eyes, once or twice a day for 1 – 2 weeks. It helps to relieve eye dryness. Triphala Ghee is also used externally in an eye procedure called Tarpana. Triphala Ghee Uses for Tarpana Take ½ -1 teaspoon Triphala Ghee once or twice a day, preferably after meals Drink lukewarm water after taking it. Externally, it is used for eye treatment called Tarpana. Here, a compound around both eyes is made with the help of black gram paste. Melted Triphala Ghritha is retained in the compound for a few minutes. The patient’s eyes are immersed in the ghee medium during this procedure. The patient is asked to blink and open their eyes so that the herbal ghee components enter deep into the eyes and bring about therapeutic benefits. Triphala Ghee Uses with Allopathic medicines This ghee can also be used with Homeopathy and allopathic medicine. This medicinal Ghee can be continued while taking supplements like multivitamin tablets, omega-3 fatty acids, etc. However, if you are taking more than one product per day, please consult your doctor for an opinion. Seek your doctor’s advice if you are taking this product along with other allopathic medicines. Some Ayurvedic herbs can interact with modern medicine. If both Ayurvedic and allopathic medicines are advised together, then it is best to take the Allopathic medicine first, wait for 30 minutes and then take the Ayurvedic medicine. However, it is best to use this product under medical supervision. Self-medication with this medicine is discouraged. People with diabetes, high cholesterol, heart disease and high BP should exercise precautions. In very high doses, it may cause diarrhea and indigestion. Regarding eye application of Triphala Ghee If this Ghee is preserved hygienically, it is not sterile. No need to warm it. After applying, it can be washed off with hot water after 5 – 10 minutes.  Ashwagandha Ghee, a powerful fusion of the adaptogen herb Ashwagandha and nutrient-rich ghee, is rapidly gaining global recognition for its remarkable array of medicinal benefits. Ashwagandha Ghee Ingredients: A2 cultured cow ghee, Ashwagandha Churna, Ashwagandha Kwath, A2 Gir cow milk, and Water of River Benefits of Ashwagandha Ghee Reduces Stress And Anxiety: The combination of Ashwagandha and ghee effectively combats stress and reduces anxiety. Ashwagandha’s adaptogenic properties help lower the production of stress hormones like cortisol, which are linked to feelings of anxiety and stress. Therefore, Ashwagandha ghee positively influences the body’s hormonal balance, promoting overall well-being. Improves Energy levels: Stress and fatigue can significantly deplete energy levels. However, Ashwagandha Ghee has been found to effectively reduce stress and boost energy levels. Additionally, the digestive properties of ghee play a vital role in maintaining gut health, thereby enhancing the absorption of nutrients. This combination makes Ashwagandha ghee a powerful aid in promoting overall well-being and vitality. Boost Immunity:- Ashwagandha ghee offers remarkable benefits for women’s health. It plays a crucial role in regulating menstrual cycles, flow and addressing issues like irregular periods and menstrual cramps. Hormonal imbalances often underlie these concerns, but regular consumption of Ashwagandha ghee can help restore balance and strengthen the adrenal glands. Regulate Menstrual Cycle: Moreover, the stress-reducing properties of Ashwagandha ghee bolster the endocrine system, rendering it especially advantageous in addressing symptoms linked to Polycystic Ovary Syndrome (PCOS). Additionally, by nourishing the body deeper, Ashwagandha ghee enhances overall reproductive health, thus positioning it as a valuable inclusion in women’s wellness routines. Improves Fertility:- Ashwagandha Ghee offers notable benefits for women’s reproductive health. It aids in promoting ovulation, regulating menstrual cycles, and easing menstrual pain, potentially through its positive influence on the endocrine system. By balancing the thyroid and adrenal glands, Ashwagandha Ghee supports the regulation of reproductive hormones, contributing to overall menstrual health and well-being. The blend of Ashwagandha with milk is an Ayurvedic remedy with multiple advantages: Stress Management: Ashwagandha’s adaptogenic properties, paired with milk, promote stress relief. Better Sleep: The duo’s calming effects may improve sleep quality. Immune Support: Ashwagandha and milk contribute to overall immune health. Natural Treatment for erectile dysfunction. Bone Strength: Rich in calcium, milk, along with ashwagandha, supports bone density. Hormonal Balance: Ashwagandha, combined with milk’s nutrients, aids in hormonal balance. Uses of Ashwagandha Ghee: Dosage Form: Ghee Single Maximum Dose: 10 g Before or After Meal: After Meal Preferred way of taking: Milk Frequency: Can take Twice Daily Usage Tips: Mix 1/2 to 1 teaspoon of Ashwagandha ghee in warm milk. Optional: Add honey for sweetness. It is best consumed before bedtime for potential sleep benefits.
WeightN/AN/AN/AN/AN/AN/A
DimensionsN/AN/AN/AN/AN/AN/A
Additional information
Size

1 LTR, 15 KG, 2 LTR, 5 LTR

Weight N/A
Size

1 LTR, 100 ML, 15 KG, 2 LTR, 250 ML, 5 LTR, 500 ML

Size

100 ML, 1000 ML, 250 ML, 500 ML

Weight N/A
Size

1 LTR, 100 ML, 15 KG, 2 LTR, 250 ML, 5 LTR, 500 ML

Size

100 ML, 1000 ML, 250 ML, 500 ML

Size

100 ML, 1000 ML, 250 ML, 500 ML

Sold1813713401
Shipping
Select the fields to be shown. Others will be hidden. Drag and drop to rearrange the order.
  • Image
  • SKU
  • Rating
  • Price
  • Stock
  • Description
  • Weight
  • Dimensions
  • Additional information
  • Add to cart
Click outside to hide the comparison bar
Compare
X
0
6